- IFN-gamma R1/CD119 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49406
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Cytokine Research, Immunology, Innate Immunity, Myeloid derived Suppressor Cell, Neuroscience
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Human (Hu)
- Polyclonal
- CD119, IFNGR, IMD27A, IMD27B
- interferon gamma receptor 1
- IHC, IHC-p
- This antibody was developed against a recombinant protein corresponding to amino acids: SSVPTPTNVT IESYNMNPIV YWEYQIMPQV PVFTVEVKNY GVKNSEWIDA CINISHHYCN ISDHVGDPSN SL
- Rabbit
- IgG
- IFN-gamma R1/CD119
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- 0.1 ml (also 25ul)
Specifications/Features
Available conjugates: Unconjugated
Sequence
SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL